<acronym id="1rl0q"><strong id="1rl0q"></strong></acronym><track id="1rl0q"><ruby id="1rl0q"></ruby></track>

      1. <tr id="1rl0q"><strong id="1rl0q"></strong></tr><td id="1rl0q"><option id="1rl0q"></option></td>
        <pre id="1rl0q"><del id="1rl0q"><menu id="1rl0q"></menu></del></pre>

        1. Current Location>>Home>> >>Products >>Hot Products
          GHRP-6 Acetate
          Cat#

          Peptide Name

          Peptide Sequence
          KL49703MOG 35-55MEVGWYRSPFSRVVHLYRNGK
          KL49010OVA(323-339)ISQAVHAAHAEINEAGR
          KL185974
          Trp-His-Trp-Leu-Gln-Leu-Lys-Pro-Gly-Gln-Pro-Met-Tyr
          KL297897C5a receptor antagonist Ac-Phe-[Orn-Pro-D-Cha-Trp-Arg] 6aa
          KL51586
          Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala
          KL51564
          DYKDDDDK
          KL50739GLP-1(7-36)HAEGT FTSDV SSYLE GQAAK EFIAW LVKGR- NH2
          KL52936
          [LL-37, 37 aa]
          KL66001
          RRRRRRRR
          KL55602
          Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys
          KL53270
          H-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Val-His-Lys-Lys-Gly-Gln-OH
          KL51001
          H-Asn-Leu-Val-Pro-Met-Val-Ala-Thr-Val-OH
          KL71668
          Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys-Lys
          KL51950
          His-Trp-Trp-Arg-Ala-Glu-Ser-Asp-Glu-Ala-Arg-Arg-Cys-Tyr-Asn-Asp-Pro-Lys-Cys-Cys-Asp-Phe-Val-Thr-Asn-Arg
          KL169892
          Asp-Asp-Asp-Ile-Ala-Ala-Leu-Val-Val-Asp-Asn-Gly-Ser-Gly-Met-Cys-Lys-Ala-Gly-Phe-Ala-Gly-Asp-Asp-Ala-Pro-Arg-Ala-Val-Phe-Pro-Ser-Ile-Val-Gly-Arg-Pro-Arg-His-Gln-Gly-Val-Met-Val-Gly-Met-Gly-Gln-Lys
          KL66814
          Ala-Ser-Phe-Glu-Ala-Gln-Gly-Ala-Leu-Ala-Asn-Ile-Ala-Val-Asp-Lys-Ala
          KL50243

          Glucagon Hydrochloride

          H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-OH
          KL50271
          Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
          KL53272
          DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
          KL52831
          Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
          KL149292
          Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Leu-Asn-Trp-Cys-Ala-Trp-Phe-Leu-Arg-Met
          KL52934

          FS-RM-0872-01

          Ac-Glu-Glu-Met-Gln-Arg-Arg-NH2
          KL53241GHRP-6His-D-Trp-Ala-Trp-D-Phe-Lys-NH2  
          KL53242GHRP-2H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2
          KL49759
          Ac-Ser-Tyr-Ser-Nle-Glu-His-D-Phe-Arg-Trp-Gly-Lys-Pro-Val-NH2
          KL169306
          Aib-His-D-2-Nal-D-Phe-Lys-NH2
          KL86408GRF(1-29) amide(human)Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
          KL59699

          Sermorelin Aceta 

          Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
          KL53241

          GHRP-6 Acetate

          His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
          KL48688

          Hexarelin Acetate

          H-His-D-2-Me-Trp-Ala-Trp-D-Phe-Lys-NH2
          KL53242

          GHRP-2 Acetat

          D-Ala-D-βNal-Ala-Trp-D-Phe-Lys-NH2
          KL49759MT-I Ac-Ser-Tyr-Ser-Nle-Glu-His-D-Phe-Arg-Trp-Gly-Lys-Pro-Val-NH2
          KL57561

          Teriparatide Acetate

          Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
          KL53413Adrenomedullin(1-52),human
          KL48488
          H-Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly-NH2 (Disulfide   bridge    Cys1-Cys6)
          KL50302
          H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH
          KL53403GIP(1-42)Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln
          KL50210
          H-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH     Cys7---------Cys23 
          KL102312
          Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Ala-Gly-Pro-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys
          KL49368
          His-His-His-His-His-His 

          |Home| About us|Peptide Synthesis|Latest News|Advanced Technologies|Products|Polypeptide knowledge|Contact us|

          Changzhou Kanglong Biotech Ltd. All rights reserved 星火CMS

          18禁止的观看啪啪免费
          <acronym id="1rl0q"><strong id="1rl0q"></strong></acronym><track id="1rl0q"><ruby id="1rl0q"></ruby></track>

            1. <tr id="1rl0q"><strong id="1rl0q"></strong></tr><td id="1rl0q"><option id="1rl0q"></option></td>
              <pre id="1rl0q"><del id="1rl0q"><menu id="1rl0q"></menu></del></pre>